| Basic Information | |
|---|---|
| Taxon OID | 3300014839 Open in IMG/M |
| Scaffold ID | Ga0182027_12192598 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 525 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Stordalen | |||||||
| Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006130 | Metagenome | 380 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182027_121925981 | F006130 | GAGG | MPAAKKATTRPKRRIVSPAEERTQLRLTVDSKFTKSHFNQLFAVLKIRRK |
| ⦗Top⦘ |