Scaffold Ga0182030_10000022

Overview

Basic Information

• Taxon OID: 3300014838
• Scaffold ID: Ga0182030_10000022
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 197290
• Total Scaffold Genes: 188
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 131 (69.68%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067178	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182030_10000022110	F067178	GGA	MPLAGMVASEVAITVSIELLARRAHLSLATILVDRSLLALALLVLIVRPSRAAWLPRSPRLALLRVVTGGLTFVGWFGAIGLLSGRVTQAVLLLDALILAYVRGSHRSYERRTLLVLTATLILFAAEAVREPGTVLNAPRGIIFLLIALASRAATYKVWERAQHKDEHLFWLIAPALIGATLGGFFLSAASHTALQTLSPVMWCVMLLVSMVGLTGYFYMNTVMALLGAFYTRVVELWQVPVLWAIHLYTDHSQVDLVQGTLGVLVACASAYTYLRHRRGKEELTSPSR*