NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120386_1123598

Scaffold Ga0120386_1123598


Overview

Basic Information
Taxon OID3300014826 Open in IMG/M
Scaffold IDGa0120386_1123598 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1366
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Missouri
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)578
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)41.314168Long. (o)-105.584589Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005942Metagenome / Metatranscriptome385N

Sequences

Protein IDFamilyRBSSequence
Ga0120386_11235981F005942N/AIKFPKLDWSPNADENSQPEISEEIYKLLKEDLDAITNKKAINPHEIQNGLREINFHKEFPDIYKIIDDMCLEYDLQGKEMTSEQILSFITEKLGDNKTRKGLNNIFDSLKDQKVGEITPEVLAKIAAEIGDELNEQDMKKILQTISGSSPSINITQDEFYYIMTKKPEDAFKINMATKKTK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.