| Basic Information | |
|---|---|
| Taxon OID | 3300014826 Open in IMG/M |
| Scaffold ID | Ga0120386_1102712 Open in IMG/M |
| Source Dataset Name | Sheep rumen microbial communities from Wyoming, USA - O_aries_Forg_1366 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Missouri |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 640 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 41.314168 | Long. (o) | -105.584589 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028419 | Metagenome / Metatranscriptome | 191 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120386_11027121 | F028419 | N/A | TNKGNIKLCDLRTNTDYLKFQTSFYDEKANVNNVIANSLLSVHDISANLNDKYTFATRHYFQVNLWDIRMQNSPSNKFLTYEPIINRLTYLYQNNNLADKFSLDSDINGTFILTGGYNNMFHVIDINQRLNTQIIIDDNNEKLMNTNIVRRVNAKGSCGYKKDDPHAQNINFDKKILKQAYSPVENYALLIVYNCIYSYMEILQRKNNLFFYL |
| ⦗Top⦘ |