| Basic Information | |
|---|---|
| Taxon OID | 3300014823 Open in IMG/M |
| Scaffold ID | Ga0120170_1032515 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1309 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Axel Heiberg Island, Nunavut | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | .8 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091258 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0120170_10325152 | F091258 | GGAGG | MHVAQDDDEARYLASLASQVLGIRRPQAERLADRYVRELPGSGWERFLRWISDGSRR* |
| ⦗Top⦘ |