| Basic Information | |
|---|---|
| Taxon OID | 3300014819 Open in IMG/M |
| Scaffold ID | Ga0119954_1009402 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2281 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 34.21 | Long. (o) | -83.96 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024536 | Metagenome / Metatranscriptome | 205 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119954_10094022 | F024536 | GAG | MRCLCFFLAASFVQISFAQMHMRKKQNIGIFAGGTFKDAQFNTLSAGITRSFFQFFEPEIGFRTTLPLTVSSELSSPKNTYLTAGLNLRKSLFPINQRKKGRSCRGEIIEVFAAPEYNLLVKSNTQRYDMGQFSLRTGLGIFHYQTGFSKQSKAWNVKAQVYFRYVPGPLTNTMSIKNEFGIQLRIFKFKTYDFVK* |
| ⦗Top⦘ |