Scaffold Ga0119954_1009180

Overview

Basic Information

• Taxon OID: 3300014819
• Scaffold ID: Ga0119954_1009180
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2318
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.21
  • Long. (^o): -83.96

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043934	Metagenome	155	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119954_10091804	F043934	AGGA	MAIVDISGVSAGALNLKNLMDGVLEKTIEVFEEYNVPLPSRQFWTVGEPAIDCEQLVVSFIQTYLGLPGNQASEPQRCQSPRSVVLTISISREIPVVGVNGKAPTGDKIEEASRIAVVDAWMFMELINKLDQWEPGEFGLGVIATADSSGFDGGFQTTAMQLTMVVP*