Scaffold Ga0119954_1003248

Overview

Basic Information

• Taxon OID: 3300014819
• Scaffold ID: Ga0119954_1003248
• Source Dataset Name: Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4727
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier In Georgia, Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.21
  • Long. (^o): -83.96

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023494	Metagenome / Metatranscriptome	210	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119954_10032487	F023494	AGGTGG	MKGKAALNRVFLFFPQLNRLVTTTNSIDKKFDLREQTLLRRFKSNQLSKAKTKELG*