| Basic Information | |
|---|---|
| Taxon OID | 3300014818 Open in IMG/M |
| Scaffold ID | Ga0134300_1010018 Open in IMG/M |
| Source Dataset Name | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Battelle Memorial Institute, Gulf Coast Restoration Organization |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2936 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Norway: Trondheimsfjord | |||||||
| Coordinates | Lat. (o) | 63.43 | Long. (o) | 10.43 | Alt. (m) | Depth (m) | 90 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091752 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134300_10100184 | F091752 | N/A | MSQILEQQTEFLPENIQWLGLGNKYLEGQYELIDNWGTKGLDKKDSYDTNFQNEYDFVLDNMKLG* |
| ⦗Top⦘ |