NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134300_1005198

Scaffold Ga0134300_1005198


Overview

Basic Information
Taxon OID3300014818 Open in IMG/M
Scaffold IDGa0134300_1005198 Open in IMG/M
Source Dataset NameMarine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBattelle Memorial Institute, Gulf Coast Restoration Organization
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6168
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Microbial Communities To Study Oil Droplet Degradation From Trondheimsfjord, Norway

Source Dataset Sampling Location
Location NameNorway: Trondheimsfjord
CoordinatesLat. (o)63.43Long. (o)10.43Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051205Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0134300_100519812F051205AGGAGMTKLLLGFVMIALWTVGCETITTGCYGHWVKGPPERGTRALNKDAHLPYYQCVDENNKGSNLEKRSQF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.