Scaffold Ga0119960_1052292

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119960_1052292

Scaffold Ga0119960_1052292

Overview

Basic Information
Taxon OID	3300014811 Open in IMG/M
Scaffold ID	Ga0119960_1052292 Open in IMG/M
Source Dataset Name	Aquatic viral communities from ballast water - Michigan State University - AB_ballast water
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Michigan State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	679
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic → Aquatic Viral Communities From Harbor And Ballast Water - Michigan State University

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051927	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0119960_10522921	F051927	N/A	PFCFPVTIVVCGSEVIDRDKMCTACRVSEWQDQQEQAQKLRERHYALEANRDAYLGRKRAVRDSIRAGVVTAVAVMLFLAFLSATCDAMKYEWETKPAMLKQNGVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.