| Basic Information | |
|---|---|
| Taxon OID | 3300014811 Open in IMG/M |
| Scaffold ID | Ga0119960_1027085 Open in IMG/M |
| Source Dataset Name | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Michigan State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 800 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic → Aquatic Viral Communities From Harbor And Ballast Water - Michigan State University |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015974 | Metagenome / Metatranscriptome | 250 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119960_10270851 | F015974 | N/A | MDKVESMPIDDLTREFKKLEFLNELPNRPVQFMFKHKGRYFRLAKTPNEICGHHFIELQQVFNGDTIESLHKIMALLAYEVDFFGKSKTIKDAQAHYQDKCNLFLSMEVPLPYSYSLFFSAVYPELLKTIQSYLIKEMDKLNKEITQVR* |
| ⦗Top⦘ |