Scaffold Ga0119946_1020747

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0119946_1020747

Scaffold Ga0119946_1020747

Overview

Basic Information
Taxon OID	3300014801 Open in IMG/M
Scaffold ID	Ga0119946_1020747 Open in IMG/M
Source Dataset Name	Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Nanjing University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	675
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic → Aquatic Microbial Communities From Drinking Water Treatment System In Nanjing, China

Source Dataset Sampling Location
Location Name	China: Nanjing
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044464	Metagenome	154	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0119946_10207472	F044464	AGGA	MAAGLINFTTPYTPASGFYSGTGATTLVPNVFPVAINGRPYLVDLKAGSFQRQYDARVRDSVDQSAEPGE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.