Scaffold Ga0134448_1002323

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134448_1002323

Scaffold Ga0134448_1002323

Overview

Basic Information
Taxon OID	3300014794 Open in IMG/M
Scaffold ID	Ga0134448_1002323 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from obese patients in Germany - AS50_6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hohenheim
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6762
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location Name	Germany
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062845	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134448_100232310	F062845	AGGGGG	MEKTPFILHEKFRSDNNEQRKEHFQKKFERYIVDELSNAAPSKSCA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.