| Basic Information | |
|---|---|
| Taxon OID | 3300014745 Open in IMG/M |
| Scaffold ID | Ga0157377_11542521 Open in IMG/M |
| Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071343 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157377_115425211 | F071343 | N/A | MEPESVFLKPDRNSTIAGQPLKTVRAMLRELGRGEYFTVSSVEAFLRKQLWSDHVNDLAKQGKISPDNRRLYKKTGGRTNSSRNVTSLIGANGIPDQATAARALVEQLLKDGMIEVNARFSDCREQVAYQPTRWAARYVARIDRAKAEKLLADFLQCVEEVN |
| ⦗Top⦘ |