NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0172376_10115014

Scaffold Ga0172376_10115014


Overview

Basic Information
Taxon OID3300014720 Open in IMG/M
Scaffold IDGa0172376_10115014 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)1875
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameCongo: South-Kivu
CoordinatesLat. (o)-1.64Long. (o)29.05Alt. (m)Depth (m)35
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000258Metagenome / Metatranscriptome1443Y
F001900Metagenome / Metatranscriptome620Y
F073145Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0172376_101150141F073145AGGAGGMAQSVGNAKNILVGASPLFLSTIDVNDSDYVSNAEAGVAIAAGSGTVGVPAFASGVSYTTTLNNVNQTAGLFGYRNVGFTNNGLQITYNPTYDSVTVDQLLDTAKLFKSAMEVMIATEMSEGTLENIAAVFGQAASTLSDNGL
Ga0172376_101150142F000258GGAGGVTANYKLDAMLELRKYLWKELYTRNIFDEEDYWSDNLNENIVPIIPVQQAAEMNQFLSGKKHIVYDKIGMSYEDNWLICCEQIMFTLYSTSVADINEIRNYMTDEFRRMDESAKDINKWADLSDKFKFHSIWIADISPTAPSEELQGFFSAEVILEIKYSRITDNTGRFL*
Ga0172376_101150143F001900GGAMLVQAASGLERMMYANQNGPLKDSTVAQISAYVYYEASVLSKLTTNAQFKALFTKIMFDQINLDFGNYIDALARSKPKSLHHVYEWKKTGNKTARLFKLNKISEEGLSFRINYDFLLSRSMVPAPSGRRRHMFANKAAVMEAGKPLVIRPKNAERLVFEVDGETVFMPKGKSVTVRRPGGSASTNQFTLAHSRFFSGNLVNTSIKNSGFQRIFNSSMSKALRVPSNIKKVQYSFSPNLIRSQADAALMASFGGAM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.