Basic Information | |
---|---|
Taxon OID | 3300014716 Open in IMG/M |
Scaffold ID | Ga0135282_10697 Open in IMG/M |
Source Dataset Name | Maize phyllosphere microbial communities from California to study drought stress - PHYLLO11_watered_CA_Berkeley |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 592 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Maize Phyllosphere → Maize Phyllosphere Microbial Communities From Texas And California To Study Drought Stress |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Berkeley, California | |||||||
Coordinates | Lat. (o) | 37.53128 | Long. (o) | -122.7598 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046965 | Metagenome / Metatranscriptome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0135282_106971 | F046965 | N/A | DSHARIDELNASIASLRNENEKLIAKAKDFDVCNTTISDLRTKNDLLHAKVIELKSCKPSTSTIEHVSICTRCRDINVDAIHDHLALIKKQNDHIAQLNAKIREHDLENEKFKLARSMLYNGRRPGIKDGIGFQRGDNVKINAPPKNLSNFVKGKAPMPQDNEGYILYPAGYPENKIKKIHSRKSHSGPNHAFMYKG |
⦗Top⦘ |