| Basic Information | |
|---|---|
| Taxon OID | 3300014711 Open in IMG/M |
| Scaffold ID | Ga0134314_106487 Open in IMG/M |
| Source Dataset Name | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 763 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water → Surface And Well Water Microbial Communities From Bara Haldia, Bangladesh |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangladesh: Bara Haldia, Matlab upazilla | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001923 | Metagenome / Metatranscriptome | 617 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134314_1064871 | F001923 | N/A | MSPTPPSFDHEQTQAMVKDGLVASILGGLAMTARLLLSTEPVSIGWVVRRVSAAAIVAAVVGYGIQEHISSPGLRMAVVGAAGYAAPEVLDYLLKYIKAGAPEDVVED |
| ⦗Top⦘ |