Scaffold Ga0121282_101885

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0121282_101885

Scaffold Ga0121282_101885

Overview

Basic Information
Taxon OID	3300014670 Open in IMG/M
Scaffold ID	Ga0121282_101885 Open in IMG/M
Source Dataset Name	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P01215
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Weill Cornell Medical College
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2804
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location Name	USA:New York City
Coordinates	Lat. (^o)	40.86	Long. (^o)	-73.89	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0121282_1018854	F037503	N/A	MFLGTASAWSLIEVELPIGCGGVKSYQIQTNSECYKIWPAVRLWVLRSKAERERTQTIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.