| Basic Information | |
|---|---|
| Taxon OID | 3300014652 Open in IMG/M |
| Scaffold ID | Ga0134319_100112 Open in IMG/M |
| Source Dataset Name | Alkaline hot spring microbial communities from Galicia, Spain - Lobios hot spring |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The University of A Coru?a |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 28840 |
| Total Scaffold Genes | 31 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (67.74%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Alkaline Hot Spring → Alkaline Hot Spring Microbial Communities From Galicia, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Lobios, Galicia | |||||||
| Coordinates | Lat. (o) | 41.86113 | Long. (o) | -8.1062 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099502 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134319_10011210 | F099502 | AGGAG | MAEKANQESAIGTIIGWGSLGIFALWFAYQVASPLLIGEQWAEKQQDAIELVKNSKPLGNDTLYDMIRAYSLKAKENDFFVGEFSWSAIQKDGPEYEVTLLWTEGEQKKVALWRVNLENKEVRPQGDAASLPQRLAAGPPKKPAGS* |
| ⦗Top⦘ |