Scaffold Ga0134450_100271

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134450_100271

Scaffold Ga0134450_100271

Overview

Basic Information
Taxon OID	3300014552 Open in IMG/M
Scaffold ID	Ga0134450_100271 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from obese patients in Germany - AS56_6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hohenheim
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	44978
Total Scaffold Genes	41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	32 (78.05%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Source Dataset Sampling Location
Location Name	Germany
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047125	Metagenome / Metatranscriptome	150	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134450_10027137	F047125	AGGA	MDVVLLLMVLGVMLSGFRAADALDHMREEIIRQEGKRRGWWS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.