| Basic Information | |
|---|---|
| Taxon OID | 3300014502 Open in IMG/M |
| Scaffold ID | Ga0182021_10322433 Open in IMG/M |
| Source Dataset Name | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1822 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden: Stordalen | |||||||
| Coordinates | Lat. (o) | 68.35 | Long. (o) | 19.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053661 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182021_103224333 | F053661 | GGA | MVVGKMVDMKDYYQTNKGRLLGIGGILILVGLILYFARHQEAVLILPIIGVVLFIAGVFYKPKKKEQTTATTHNLKL* |
| ⦗Top⦘ |