Scaffold Ga0182008_10560033

Overview

Basic Information

• Taxon OID: 3300014497
• Scaffold ID: Ga0182008_10560033
• Source Dataset Name: Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 636
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1591
  • Long. (^o): -96.4086

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035472	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182008_105600332	F035472	N/A	MNRSVRIPLLSLGAALALVVLGACGSELSAFGDACSVYAVENDCESPNQCMCRVNAPYCVCSHRCEQDKDCPGGSVCLPGQNPANNQQDLFCFKGD