| Basic Information | |
|---|---|
| Taxon OID | 3300014497 Open in IMG/M |
| Scaffold ID | Ga0182008_10473959 Open in IMG/M |
| Source Dataset Name | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 684 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Nebraska | |||||||
| Coordinates | Lat. (o) | 41.1591 | Long. (o) | -96.4086 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005831 | Metagenome / Metatranscriptome | 389 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0182008_104739591 | F005831 | AGGAGG | MTGSMHVADHQGDTTHTWDTADPATIREIEELFREAQASGRLVYRQTSDGRGEQVRLASWNPEQHTEL |
| ⦗Top⦘ |