Scaffold Ga0182008_10303422

Overview

Basic Information

• Taxon OID: 3300014497
• Scaffold ID: Ga0182008_10303422
• Source Dataset Name: Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 836
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Sorghum-Associated Microbial Communities From Plants Grown In Nebraska, Usa

Source Dataset Sampling Location

• Location Name: USA: Nebraska
• Coordinates
  • Lat. (^o): 41.1591
  • Long. (^o): -96.4086

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091829	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182008_103034222	F091829	AGGA	MIGVIFAIGIAGLVVFFIIGAAWYAWGFLGAFLFVVAVLAVIAWSLDRSRARRYDDLSDA