Scaffold Ga0182011_10254678

Overview

Basic Information

• Taxon OID: 3300014496
• Scaffold ID: Ga0182011_10254678
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1177
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008316	Metagenome / Metatranscriptome	335	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182011_102546782	F008316	GAG	MTLKSAAFFALIGMTLLTVLLAVGFIRDVSALSAGAIAAITLLKSLIYLLASLSVAVFLLVFYKAQP*