Scaffold Ga0182018_10052384

Overview

Basic Information

• Taxon OID: 3300014489
• Scaffold ID: Ga0182018_10052384
• Source Dataset Name: Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2493
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Citrifermentans → Citrifermentans pelophilum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa → Permafrost Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Stordalen
• Coordinates
  • Lat. (^o): 68.35
  • Long. (^o): 19.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022967	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182018_100523843	F022967	N/A	MQHSAREVVEAAGVEPASENVTGQETTCLFQFMPWALPQDVRDPRS