NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182001_10124664

Scaffold Ga0182001_10124664


Overview

Basic Information
Taxon OID3300014488 Open in IMG/M
Scaffold IDGa0182001_10124664 Open in IMG/M
Source Dataset NameBulk soil microbial communities from Mexico - San Felipe (SF) metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)840
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameMexico: San Luis Potosi
CoordinatesLat. (o)21.766Long. (o)-100.163Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007136Metagenome357Y

Sequences

Protein IDFamilyRBSSequence
Ga0182001_101246641F007136AGGAGVGSKVRTPDYFGWLVAASVGALLSAVVTAICVKYEDRWLAWFGAAAFFVSALAAAYWLVKLL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.