NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182000_10215444

Scaffold Ga0182000_10215444


Overview

Basic Information
Taxon OID3300014487 Open in IMG/M
Scaffold IDGa0182000_10215444 Open in IMG/M
Source Dataset NameBulk soil microbial communities from Mexico - Magueyal (Ma) metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)746
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Agave Microbial Communities From California, Usa, And Mexico

Source Dataset Sampling Location
Location NameMexico: Magueyal, Guanajuato
CoordinatesLat. (o)21.195Long. (o)-100.439Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034334Metagenome175Y

Sequences

Protein IDFamilyRBSSequence
Ga0182000_102154441F034334N/AASAVVGYYFARKRTEYEVGYRHRVEVAEVVQGMVIPLVEEFEAALEYVRAPGPAGELPIEELERSVDGLEKYVEQQELWLDRQSSSALGDLIAGFRARQRELQLLPRRYDDPGFERAYGRAGADLDGWLRAELPAVREELDEALRGMLGIGRWRHGVP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.