NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0135353_115144

Scaffold Ga0135353_115144


Overview

Basic Information
Taxon OID3300014358 Open in IMG/M
Scaffold IDGa0135353_115144 Open in IMG/M
Source Dataset NameHuman colon tissue microbial communities from Howard University Cancer Center, USA - CC0961
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHiThru Analytics LLC
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)565
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa

Source Dataset Sampling Location
Location NameUSA: Washington, D.C
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042936Metagenome157N

Sequences

Protein IDFamilyRBSSequence
Ga0135353_1151441F042936N/AMGRGGGKGRVWKTKEGIMKTSEIVDRGEDTIRNFEKVEQKGALTPPYLGKVYFRSRLRGKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.