Scaffold Ga0135353_115144

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0135353_115144

Scaffold Ga0135353_115144

Overview

Basic Information
Taxon OID	3300014358 Open in IMG/M
Scaffold ID	Ga0135353_115144 Open in IMG/M
Source Dataset Name	Human colon tissue microbial communities from Howard University Cancer Center, USA - CC0961
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	HiThru Analytics LLC
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	565
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Unclassified → Human Colon Tissue → Human Fecal And Colon Tissue Microbial Communities From Howard University Cancer Center, Usa

Source Dataset Sampling Location
Location Name	USA: Washington, D.C
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042936	Metagenome	157	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0135353_1151441	F042936	N/A	MGRGGGKGRVWKTKEGIMKTSEIVDRGEDTIRNFEKVEQKGALTPPYLGKVYFRSRLRGKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.