Scaffold Ga0134346_1003616

Overview

Basic Information

• Taxon OID: 3300014293
• Scaffold ID: Ga0134346_1003616
• Source Dataset Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_107
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The George Washington University (GWU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4926
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location

• Location Name: USA: Maryland
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068942	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134346_10036166	F068942	N/A	RKILSLPTLALCFTLCTALFAGCGENNEGFVTKVRWSNVKNPKYGDDINITLKAEGETFTTVGDHSQIFFGYDASTLDTFTRHRFPKVDKDTAYYKDIVIYLTRNESKGTATLKLVAPPNRTQQPKHFKFSVSVTPPGTYFFNVRQPALPAKAQ*