Basic Information | |
---|---|
Taxon OID | 3300014293 Open in IMG/M |
Scaffold ID | Ga0134346_1000529 Open in IMG/M |
Source Dataset Name | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_107 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The George Washington University (GWU) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14466 |
Total Scaffold Genes | 22 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 20 (90.91%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maryland | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084362 | Metagenome | 112 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134346_10005297 | F084362 | GGAGG | MSLMNCTFTVRWSDDKNKPHAKTYDTEDDAKRAKKWLLEHGVRSVDIAVKINNKPAGSLKDDKQSETEAEQKGFWWEK* |
⦗Top⦘ |