Scaffold Ga0121464_109604

Overview

Basic Information

• Taxon OID: 3300014288
• Scaffold ID: Ga0121464_109604
• Source Dataset Name: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Weill Cornell Medical College
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location

• Location Name: USA:New York City
• Coordinates
  • Lat. (^o): 40.63
  • Long. (^o): -73.99

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062643	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0121464_1096041	F062643	N/A	MVVAQTPDQRVALEGSIPTGLALGSAECTELVPAGLLQAASGGGLAPGYQLISPDLGIPSLFSNLQVMCCALV*