NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0121464_106534

Scaffold Ga0121464_106534


Overview

Basic Information
Taxon OID3300014288 Open in IMG/M
Scaffold IDGa0121464_106534 Open in IMG/M
Source Dataset NameUrban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWeill Cornell Medical College
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)640
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location NameUSA:New York City
CoordinatesLat. (o)40.63Long. (o)-73.99Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043815Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0121464_1065341F043815N/AKGRGDGLHENFGCYNFAYRKTTKFPVISYRSKWPAGWKSEWFYVKVDKDEDKLVQSPLELTFGETRPRCNMIRGSPSQTAMAEFRVISDHIGTRDLVQEFLAFKVFPTMRDWEMPKLEGEKKKGELVRLPYHYKFKKHFKKPCQKWLDTIEIMCNDILGNYSKKEDQLMTAAFGSRPKRRLNRVLDALNFDYPDYEQLGGDAGGPKRKRIAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.