Basic Information | |
---|---|
Taxon OID | 3300014288 Open in IMG/M |
Scaffold ID | Ga0121464_105473 Open in IMG/M |
Source Dataset Name | Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal/plastic -P00191 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Weill Cornell Medical College |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 709 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal/Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA:New York City | |||||||
Coordinates | Lat. (o) | 40.63 | Long. (o) | -73.99 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020862 | Metagenome / Metatranscriptome | 221 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0121464_1054731 | F020862 | N/A | DEAEKNSNLQKSLKELQEKCVNIGNQCLQRLKQVFNSVGASAEKFSPLVENLPETFEHIKGEVDALDEVIAGHADFCALLASRGTATAFLKAGCTHGNIVNRPNFSLSASDLLDIPSLARSIGNRFMTQIWVSGGRKMAGDEARSHLKPVRNLCLLLLPSPLKFVPFLLCCLIYTG* |
⦗Top⦘ |