NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0135164_101628

Scaffold Ga0135164_101628


Overview

Basic Information
Taxon OID3300014277 Open in IMG/M
Scaffold IDGa0135164_101628 Open in IMG/M
Source Dataset NameIndoor hospital air microbial communities from San Diego, USA - 238_L1_2014-7-25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSan Diego State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)772
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa

Source Dataset Sampling Location
Location NameUSA: San Diego, California
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003272Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
Ga0135164_1016281F003272N/APATAQVLDATYRGTMLCDKLPFTNDRMREAIEVTIAGGAARYSHVVRLSKVDVEGTTEQGTGTIDGQKISLQGGWKAGSRSYEAKYSGSFVRRSATLKGVQTWTDGGKTITRACTGAIKRPLKPFLPRAKKAG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.