NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075360_1076696

Scaffold Ga0075360_1076696


Overview

Basic Information
Taxon OID3300014261 Open in IMG/M
Scaffold IDGa0075360_1076696 Open in IMG/M
Source Dataset NameNatural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)619
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: Twitchell Island, San Francisco Bay, California
CoordinatesLat. (o)38.107521Long. (o)-121.649681Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097083Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0075360_10766961F097083N/AAMPTPTSMLYIISPERWYSLEVPTGDPASTFEMQVAPGTYQLIAFPKGSETQLFRPSAAYTTGSGISPLTVVAGQVAEGIHVKNINSDRCISVPFPASPDGRFPAIEENCSKLPTEVPQATIRGTITYQALPTPLFMLYFISPERWYSMEVPGGSPVASFELKVTPGTYQLVAFPAGSENQASRGAAAYTTGTGIGLLTVTAGEVA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.