| Basic Information | |
|---|---|
| Taxon OID | 3300014254 Open in IMG/M |
| Scaffold ID | Ga0075312_1131263 Open in IMG/M |
| Source Dataset Name | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 543 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Antioch, San Francisco Bay, California | |||||||
| Coordinates | Lat. (o) | 38.052479 | Long. (o) | -121.7687 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005116 | Metagenome | 411 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075312_11312631 | F005116 | AGGA | MWKFNTIPDPKAVERFIDAQVPLFSRNINYINGGDGQPIVDIMKVEHNCGAVNLEFQLNGIEGHAGDVFCFPSYYPGDTDYEGDPLFNRCDTNGHYYGKIVGIILGRAQKVFDLEVTTSVKKQRQFHPAL* |
| ⦗Top⦘ |