| Basic Information | |
|---|---|
| Taxon OID | 3300014253 Open in IMG/M |
| Scaffold ID | Ga0135161_11072 Open in IMG/M |
| Source Dataset Name | Indoor hospital air microbial communities from San Diego, USA - 235_L1_2014-7-22 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | San Diego State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1554 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Diego, California | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003272 | Metagenome / Metatranscriptome | 496 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135161_110721 | F003272 | GGGGG | MMRVRHAVLAAAMMTAISAPATAQVLDATYRGTMLCDKLPFTNDRMREAIEVTIAGGAARYSHVVRLSKVDVEGTTEQGTGTIDGQKISLQGGWKAGSRSYEAKYSGSFVRRSATLKGVQTWTDGGKTITRACTGAIKRPLKPFLPRAKKAG* |
| ⦗Top⦘ |