| Basic Information | |
|---|---|
| Taxon OID | 3300014228 Open in IMG/M |
| Scaffold ID | Ga0135143_10036 Open in IMG/M |
| Source Dataset Name | Indoor hospital air microbial communities from San Diego, USA - 211_L1_2014-6-9 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | San Diego State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air → Indoor Hospital Air Microbial Communities From San Diego, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: San Diego, California | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046363 | Metagenome / Metatranscriptome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135143_100361 | F046363 | N/A | IFAHGFGRDGFRSMVLDASACINMYCNIERNIMKNQAGSPGFGIQGKISVHMCFMCYALALFIFCVLEFVCR* |
| ⦗Top⦘ |