Scaffold Ga0172381_10677293

Overview

Basic Information

• Taxon OID: 3300014204
• Scaffold ID: Ga0172381_10677293
• Source Dataset Name: Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 782
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate → Leachate And Groundwater Microbial Communities From A Municipal Landfill And Adjacent Aquifer In Southern Ontario, Canada

Source Dataset Sampling Location

• Location Name: Canada: Ontario
• Coordinates
  • Lat. (^o): 43.442
  • Long. (^o): -80.577

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078673	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0172381_106772933	F078673	GAGG	MKIDVETQCIITRENGEQVVVENITSIAVVIEFMDQKYNIFKTINELILNGRWK*