Scaffold Ga0181537_10193733

Overview

Basic Information

• Taxon OID: 3300014201
• Scaffold ID: Ga0181537_10193733
• Source Dataset Name: Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1397
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 47.1149
  • Long. (^o): -88.5476
  • Depth (m): .1 to .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005696	Metagenome / Metatranscriptome	392	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181537_101937333	F005696	N/A	PILAAALMLLPHPCGAQSSTGCPVKIRHTNWQAASSGFSPYKVKGLALHLQYMNVTGEEIKEVVFDASTSYREHGAMGQSMVDKSNKSPISSVAPPGKWKKAEIDVGLSEPGRTRLRVAEVTFLSGRHWVNSTPDECEWTIAP*