| Basic Information | |
|---|---|
| Taxon OID | 3300014196 Open in IMG/M |
| Scaffold ID | Ga0134365_116396 Open in IMG/M |
| Source Dataset Name | Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_116 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The George Washington University (GWU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 772 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maryland | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068942 | Metagenome | 124 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134365_1163962 | F068942 | N/A | KILSLPTLALCFTLCTALFAGCGENYDGSVTEVHWSNVKNPEYGNAINITLKAEGETFTTVGDHSWISFSNDASTLDTFTRHRFPEVDKDTAYYKDIVIYMTRNERERTTTLKLVAPPNRTQQPKQFKFSVSVTPPGLYIFKVRQPALPAKAQ* |
| ⦗Top⦘ |