Scaffold Ga0134365_100177

Overview

Basic Information

• Taxon OID: 3300014196
• Scaffold ID: Ga0134365_100177
• Source Dataset Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_116
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The George Washington University (GWU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 31556
• Total Scaffold Genes: 27
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (11.11%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Alloprevotella → Alloprevotella sp. oral taxon 473 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location

• Location Name: USA: Maryland
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068942	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134365_1001771	F068942	N/A	KILSLPTLALCFTLCTALFAGCGENNEGFVTKVRWSNVKNPKYGDDINITLKAEGETFTTVGDHSQIFFGYDASTLDTFTRHRFPKVDKDTAYYKDIVIYLTRNESKGTATLKLVAPPNRTQQPKHFKFSVSVTPPGTYFFNVRQPALPAKAQ*