Scaffold Ga0181532_10155840

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0181532_10155840

Scaffold Ga0181532_10155840

Overview

Basic Information
Taxon OID	3300014164 Open in IMG/M
Scaffold ID	Ga0181532_10155840 Open in IMG/M
Source Dataset Name	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1370
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	47.1149	Long. (^o)	-88.5476	Alt. (m)		Depth (m)	.3 to .4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017679	Metagenome	239	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0181532_101558401	F017679	N/A	MSRPAVAITYISEGAIRAKPMDGPAQSRRKKSRSDMTHLQSLPSTQPATKIGQVTWVWAEIEAGLAAGMKLKEIWQAASRDGLEMSYAQFRIYISRLRHRRQRPTAIHTQPPPTLANGEPALPVPPLHDPFRNLREQREKKKLTTFEYDPFSINKSLID*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.