| Basic Information | |
|---|---|
| Taxon OID | 3300014164 Open in IMG/M |
| Scaffold ID | Ga0181532_10065251 Open in IMG/M |
| Source Dataset Name | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2353 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 47.1149 | Long. (o) | -88.5476 | Alt. (m) | Depth (m) | .3 to .4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020409 | Metagenome / Metatranscriptome | 224 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181532_100652513 | F020409 | GAGG | MGDLTLVALSCDHLNTYLLVAGDSLVEVQRETEKAQSLSSTAKIFFQRQSKTALIRFNKRRKKSLCQMKYFALFFFVLSTLSATAMPPNVRHYGSSGETFNGPDRTITWRPWHKGSEGDFRFRIGDRYLGHCEWEHYLGFAQYLASVKAIKLSMIHLGSEVVPDDVVIRPGLRYAIVKVTNDTMTAHKGVWSWTMQEVH* |
| ⦗Top⦘ |