Scaffold Ga0134075_10063338

Overview

Basic Information

• Taxon OID: 3300014154
• Scaffold ID: Ga0134075_10063338
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1538
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Angelo Coastal Reserve, California
• Coordinates
  • Lat. (^o): 39.7181
  • Long. (^o): -123.6527
  • Depth (m): .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077121	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134075_100633381	F077121	N/A	ARAPSYVSYSLLSNMRQGRSRAGQWGFYLTFEQLGFVVGSLIGGFLYVRNHTNVLITTSALFIVLAALAAFRIKKGAAGS*