| Basic Information | |
|---|---|
| Taxon OID | 3300014149 Open in IMG/M |
| Scaffold ID | Ga0181613_1041938 Open in IMG/M |
| Source Dataset Name | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1274 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water → In Situ Water Column Microbial Community From The Vent Pool Of Chocolate Pots Hot Spring, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.7101 | Long. (o) | -110.7413 | Alt. (m) | Depth (m) | .05 to .1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047487 | Metagenome / Metatranscriptome | 149 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181613_10419382 | F047487 | AGG | VNTLYGYIAALVVIIFLAAGWAREHDKRIVFEAQIAQAAQDAERRAAEINAKYQEEMKNAEQNTITAANAIADWYRAHPVVRVQHAGCGQVPGSADSPQGADGTSPGGYVSPYSPEETEQVANRLDQLQKLLRADGVRVE* |
| ⦗Top⦘ |