Scaffold Ga0134356_107035

Overview

Basic Information

• Taxon OID: 3300014104
• Scaffold ID: Ga0134356_107035
• Source Dataset Name: Human oral microbial communities of schizophrenia patients from Maryland, USA - ES_010
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The George Washington University (GWU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 672
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Throat → Human Oral → Human Oral Microbial Communities Of Schizophrenia Patients From Maryland, Usa

Source Dataset Sampling Location

• Location Name: USA: Maryland
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035108	Metagenome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134356_1070351	F035108	GAG	MLTGRPAEEMPGSTGDLLPELSQLHEQVRQVMQGVAQALWPSVSLLEGVAELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCRLDI