| Basic Information | |
|---|---|
| Taxon OID | 3300014060 Open in IMG/M |
| Scaffold ID | Ga0119967_10296080 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, Berkeley |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 690 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Geyser, Utah, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: near Green River, Utah | |||||||
| Coordinates | Lat. (o) | 38.938 | Long. (o) | -110.08 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012423 | Metagenome / Metatranscriptome | 280 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0119967_102960802 | F012423 | N/A | MVLTKYKGDNCELSIGISNDANSTSQNYGMSLCLKDDAGVEYTLWVITVLGTIITGGFSKIIDTNKIKKNKFYLEKATTYNYTATIPLPEFETEGKIYGQFGIYDGTDEDSVLIAETTYDYVYYYQKKKFSMSLSVDWK* |
| ⦗Top⦘ |